PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007711
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 123aa    MW: 14360.7 Da    PI: 10.1395
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007711genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.71.4e-131149341
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                 ien+s  +v++ k + g++KK  ELS+LC+++++ ii  
  Lus10007711 11 IENESSMKVSLKKWKRGLMKKVRELSTLCEIQACAIINK 49
                 9**********************************9954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.624147IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-11162IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-16298IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-5323IPR002100Transcription factor, MADS-box
PfamPF003195.9E-121153IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MTRNKAKLVC IENESSMKVS LKKWKRGLMK KVRELSTLCE IQACAIINKP YDEAQTSETW  60
PPTLGRVHQG LTCFKNMPNM EQPKNMINRE EFLANRIEKT REHINKYDRD NHQKAVIHYR  120
TG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376202.12e-32PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0A0LVS33e-31A0A0A0LVS3_CUCSA; Uncharacterized protein
STRINGPOPTR_0005s00420.16e-31(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-21AGAMOUS-like 80